PDB entry 1rku

View 1rku on RCSB PDB site
Description: Crystal Structure of ThrH gene product of Pseudomonas Aeruginosa
Class: transferase
Keywords: Phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, ThrH, phosphoserine phosphoryl donor, TRANSFERASE
Deposited on 2003-11-23, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.191
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homoserine kinase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: ThrH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I2Y2 (1-205)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1rkua1, d1rkua2
  • Chain 'B':
    Compound: homoserine kinase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: ThrH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I2Y2 (1-205)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1rkub1, d1rkub2
  • Heterogens: MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rkuA (A:)
    dmeiacldlegvlvpeiwiafaektgidalkattrdipdydvlmkqrlrildehglklgd
    iqeviatlkplegavefvdwlrerfqvvilsdtfyefsqplmrqlgfptllchkleidds
    drvvgyqlrqkdpkrqsviafkslyyrviaagdsyndttmlseahagilfhapenviref
    pqfpavhtyedlkreflkassrslsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rkuB (B:)
    dmeiacldlegvlvpeiwiafaektgidalkattrdipdydvlmkqrlrildehglklgd
    iqeviatlkplegavefvdwlrerfqvvilsdtfyefsqplmrqlgfptllchkleidds
    drvvgyqlrqkdpkrqsviafkslyyrviaagdsyndttmlseahagilfhapenviref
    pqfpavhtyedlkreflkassrslsl