PDB entry 1rkt

View 1rkt on RCSB PDB site
Description: Crystal structure of yfiR, a putative transcriptional regulator from Bacillus subtilis
Deposited on 2003-11-23, released 2004-04-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-13, with a file datestamp of 2004-04-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.21
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rktA (A:)
    mspkvtkehkdkrqaeileaaktvfkrkgfelttmkdvveesgfsrggvylyfssteemf
    rriietgldeglrkldksaehqsvwasissyldelteglrdvadtlapvqfeylvtawrn
    eerrqylekrydlfverfsrllqkgidqgefqpvqplatiakfflnmndgiiqnalyfde
    ekadvsglaesaklylktvlqadek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rktA (A:)
    spkvtkehkdkrqaeileaaktvfkrkgfelttmkdvveesgfsrggvylyfssteemfr
    riietgldeglrkldksaehqsvwasissyldelteglrdvadtlapvqfeylvtawrne
    errqylekrydlfverfsrllqkgidqgefqpvqplatiakfflnmndgiiqnalyfdee
    kadvsglaesaklylktvlqadek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rktB (B:)
    mspkvtkehkdkrqaeileaaktvfkrkgfelttmkdvveesgfsrggvylyfssteemf
    rriietgldeglrkldksaehqsvwasissyldelteglrdvadtlapvqfeylvtawrn
    eerrqylekrydlfverfsrllqkgidqgefqpvqplatiakfflnmndgiiqnalyfde
    ekadvsglaesaklylktvlqadek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rktB (B:)
    tkehkdkrqaeileaaktvfkrkgfelttmkdvveesgfsrggvylyfssteemfrriie
    tgldeglrkldksaehqsvwasissyldelteglrdvadtlapvqfeylvtawrneerrq
    ylekrydlfverfsrllqkgidqgefqpvqplatiakfflnmndgiiqnalyfdeekadv
    sglaesaklylktvlqadek