PDB entry 1rkr

View 1rkr on RCSB PDB site
Description: crystal structure of azurin-I from alcaligenes xylosoxidans ncimb 11015
Class: electron transport
Keywords: electron transport
Deposited on 1997-05-17, released 1998-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.173
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: azurin-I
    Species: Achromobacter xylosoxidans [TaxId:85698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rkra_
  • Chain 'B':
    Compound: azurin-I
    Species: Achromobacter xylosoxidans [TaxId:85698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rkrb_
  • Chain 'C':
    Compound: azurin-I
    Species: Achromobacter xylosoxidans [TaxId:85698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rkrc_
  • Chain 'D':
    Compound: azurin-I
    Species: Achromobacter xylosoxidans [TaxId:85698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rkrd_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rkrA (A:)
    aecsvdiagndgmqfdkkeitvsksckqftvnlkhpgklaknvmghnwvltkqadmqgav
    ndgmaagldnnyvkkddarviahtkvigggetdsvtfdvsklaagedyayfcsfpghfal
    mkgvlklvd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rkrB (B:)
    aecsvdiagndgmqfdkkeitvsksckqftvnlkhpgklaknvmghnwvltkqadmqgav
    ndgmaagldnnyvkkddarviahtkvigggetdsvtfdvsklaagedyayfcsfpghfal
    mkgvlklvd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rkrC (C:)
    aecsvdiagndgmqfdkkeitvsksckqftvnlkhpgklaknvmghnwvltkqadmqgav
    ndgmaagldnnyvkkddarviahtkvigggetdsvtfdvsklaagedyayfcsfpghfal
    mkgvlklvd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rkrD (D:)
    aecsvdiagndgmqfdkkeitvsksckqftvnlkhpgklaknvmghnwvltkqadmqgav
    ndgmaagldnnyvkkddarviahtkvigggetdsvtfdvsklaagedyayfcsfpghfal
    mkgvlklvd