PDB entry 1rkq

View 1rkq on RCSB PDB site
Description: Crystal structure of HAD-like phosphatase yidA from E. coli
Class: structural genomics, unknown function
Keywords: Two domain structure with beta-alpha sandwich. Stucture contains a Magnesium Ion., PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, structural genomics, unknown function
Deposited on 2003-11-23, released 2004-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yidA
    Species: Escherichia coli [TaxId:562]
    Gene: YIDA, B3697, C4619, SF3767, S4004
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8Y5 (3-271)
      • cloning artifact (1-2)
      • conflict (238)
    Domains in SCOPe 2.07: d1rkqa1, d1rkqa2
  • Chain 'B':
    Compound: Hypothetical protein yidA
    Species: Escherichia coli [TaxId:562]
    Gene: YIDA, B3697, C4619, SF3767, S4004
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8Y5 (3-271)
      • cloning artifact (1-2)
      • conflict (238)
    Domains in SCOPe 2.07: d1rkqb1, d1rkqb2
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rkqA (A:)
    mslaikliaidmdgtlllpdhtispavknaiaaarargvnvvlttgrpyagvhnylkelh
    meqpgdycityngalvqkaadgstvaqtalsyddyrfleklsrevgshfhaldrttlyta
    nrdisyytvhesfvatiplvfceaekmdpntqflkvmmidepaildqaiaripqevkeky
    tvlksapyfleildkrvnkgtgvksladvlgikpeeimaigdqendiamieyagvgvavd
    naipsvkevanfvtksnledgvafaiekyvlneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rkqA (A:)
    slaikliaidmdgtlllpdhtispavknaiaaarargvnvvlttgrpyagvhnylkelhm
    eqpgdycityngalvqkaadgstvaqtalsyddyrfleklsrevgshfhaldrttlytan
    rdisyytvhesfvatiplvfceaekmdpntqflkvmmidepaildqaiaripqevkekyt
    vlksapyfleildkrvnkgtgvksladvlgikpeeimaigdqendiamieyagvgvavdn
    aipsvkevanfvtksnledgvafaiekyvln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rkqB (B:)
    mslaikliaidmdgtlllpdhtispavknaiaaarargvnvvlttgrpyagvhnylkelh
    meqpgdycityngalvqkaadgstvaqtalsyddyrfleklsrevgshfhaldrttlyta
    nrdisyytvhesfvatiplvfceaekmdpntqflkvmmidepaildqaiaripqevkeky
    tvlksapyfleildkrvnkgtgvksladvlgikpeeimaigdqendiamieyagvgvavd
    naipsvkevanfvtksnledgvafaiekyvlneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rkqB (B:)
    slaikliaidmdgtlllpdhtispavknaiaaarargvnvvlttgrpyagvhnylkelhm
    eqpgdycityngalvqkaadgstvaqtalsyddyrfleklsrevgshfhaldrttlytan
    rdisyytvhesfvatiplvfceaekmdpntqflkvmmidepaildqaiaripqevkekyt
    vlksapyfleildkrvnkgtgvksladvlgikpeeimaigdqendiamieyagvgvavdn
    aipsvkevanfvtksnledgvafaiekyvln