PDB entry 1rkl

View 1rkl on RCSB PDB site
Description: NMR structure of yeast oligosaccharyltransferase subunit Ost4p
Class: transferase
Keywords: membrane protein, TRANSFERASE
Deposited on 2003-11-21, released 2004-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 4 kDa subunit
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rkla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rklA (A:)
    misdeqlnslaitfgivmmtliviyhavdstmspkn