PDB entry 1rki

View 1rki on RCSB PDB site
Description: Structure of pag5_736 from P. aerophilum with three disulphide bonds
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, (beta-alpha-beta)x2, beta-loop-beta-beta, CxxC motif, UNKNOWN FUNCTION
Deposited on 2003-11-21, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.184
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZYK2 (0-97)
      • cloning artifact (98-100)
    Domains in SCOPe 2.07: d1rkia1, d1rkia2
  • Chain 'B':
    Compound: hypothetical protein
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rkib_
  • Heterogens: ACT, SO4, CL, P6G, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rkiA (A:)
    mkkhiiiktipkkeeiisrdlcdciyyydnsvickpigpskvyvstslenlekclqlhyf
    kklvknieifdevhnskpncdkcliveiggvyfvrrvngvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rkiA (A:)
    mkkhiiiktipkkeeiisrdlcdciyyydnsvickpigpskvyvstslenlekclqlhyf
    kklvknieifdevhnskpncdkcliveiggvyfvrrvngvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rkiB (B:)
    mkkhiiiktipkkeeiisrdlcdciyyydnsvickpigpskvyvstslenlekclqlhyf
    kklvknieifdevhnskpncdkcliveiggvyfvrrvngvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rkiB (B:)
    mkkhiiiktipkkeeiisrdlcdciyyydnsvickpigpskvyvstslenlekclqlhyf
    kklvknieifdevhnskpncdkcliveiggvyfvrrv