PDB entry 1rkg

View 1rkg on RCSB PDB site
Description: crystal structure of the rat vitamin D receptor ligand binding domain complexed with 2MbisP and a synthetic peptide containing the NR2 box of DRIP 205
Class: hormone/growth factor receptor
Keywords: nuclear receptor-ligand complex, nuclear receptor-coactivator interactions, hormone-growth factor receptor COMPLEX
Deposited on 2003-11-21, released 2004-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rkga_
  • Chain 'C':
    Compound: Peroxisome proliferator-activated receptor binding protein
    Database cross-references and differences (RAF-indexed):
  • Heterogens: VD1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rkgA (A:)
    lkdslrpklseeqqhiiailldahhktydptyadfrdfrppvrmdgstgsvtldlsplsm
    lphladlvsysiqkvigfakmipgfrdltsddqivllkssaievimlrsnqsftmddmsw
    dcgsqdykydvtdvskaghtlelieplikfqvglkklnlheeehvllmaicivspdrpgv
    qdaklveaiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslneehskqyrslsf
    qpensmkltplvlevfgneislvprgsmaisdpnsssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rkgA (A:)
    klseeqqhiiailldahhktydptyadfrdfrppvrmsplsmlphladlvsysiqkvigf
    akmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskag
    htlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlq
    tyircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmkltplvlevfgn
    e
    

  • Chain 'C':
    No sequence available.