PDB entry 1rkb

View 1rkb on RCSB PDB site
Description: The structure of adrenal gland protein AD-004
Class: transferase
Keywords: five-stranded parallel beta-sheet flanked by 7 alpha-helices, TRANSFERASE
Deposited on 2003-11-21, released 2005-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein AD-004
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y3D8 (1-172)
    • cloning artifact (0)
  Domains in SCOPe 2.06: d1rkba1, d1rkba2
• Heterogens: SO4, LI, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rkbA (A:)
  lmllpnilltgtpgvgkttlgkelasksglkyinvgdlareeqlydgydeeydcpilded
  rvvdeldnqmreggvivdyhgcdffperwfhivfvlrtdtnvlyerletrgynekkltdn
  iqceifqvlyeeatasykeeivhqlpsnkpeelennvdqilkwieqwikdhns