PDB entry 1rk9

View 1rk9 on RCSB PDB site
Description: Solution Structure of Human alpha-Parvalbumin (Minimized Average Structure)
Class: metal binding protein
Keywords: calcium, parvalbumin, EF-hand, NMR, lanthanide, Structural Proteomics in Europe, SPINE, Structural Genomics, METAL BINDING PROTEIN
Deposited on 2003-11-21, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parvalbumin alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20472 (1-109)
      • insertion (0)
    Domains in SCOPe 2.07: d1rk9a_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rk9A (A:)
    msmtdllnaedikkavgafsatdsfdhkkffqmvglkkksaddvkkvfhmldkdksgfie
    edelgfilkgfspdardlsaketkmlmaagdkdgdgkigvdefstlvaes