PDB entry 1rk8

View 1rk8 on RCSB PDB site
Description: Structure of the cytosolic protein PYM bound to the Mago-Y14 core of the exon junction complex
Deposited on 2003-11-21, released 2004-04-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-13, with a file datestamp of 2004-04-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.235
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1rk8a_
  • Chain 'B':
    Domains in SCOP 1.67: d1rk8b_
  • Chain 'C':
    Domains in SCOP 1.67: d1rk8c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rk8A (A:)
    madvldidnaeefevdedgdqgivrlkekakhrkgrgfgsdsntreaihsyervrneddd
    elepgpqrsvegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalve
    yethkqalaakealngaeimgqtiqvdwcfvkgpkrvkksekrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rk8A (A:)
    pqrsvgwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyethkq
    alaakealngaeimgqtiqvdwcfvkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rk8B (B:)
    mstedfylryyvghkgkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmee
    lkriiidseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpegl
    rcfyylvqdlkclvfsliglhfkikpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rk8B (B:)
    edfylryyvgheflefefrpdgklryanmirkeafvhqsvmeelkriiidseimqeddlp
    wpppdrvgrqeleivigdehisfttsktgslvdvnrskdpeglrcfyylvqdlkclvfsl
    iglhfki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rk8C (C:)
    mstylqssegkfipatkrpdgtwrkarrvkdgyvpqeevplyeskgkqfvaqrqagvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rk8C (C:)
    tylqssegkfipatkrpdgtwrkarrvkdgyvp