PDB entry 1rk7

View 1rk7 on RCSB PDB site
Description: Solution structure of apo Cu,Zn Superoxide Dismutase: role of metal ions in protein folding
Class: oxidoreductase
Keywords: apo form of monomeric mutant of Cu,Zn SOD; solution structure, NMR, Q133M2SOD
Deposited on 2003-11-21, released 2003-12-02
The last revision prior to the SCOP 1.73 freeze date was dated 2003-12-02, with a file datestamp of 2007-06-04.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Superoxide dismutase [Cu-Zn]
  Species: HOMO SAPIENS
  Gene: SOD1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00441 (0-152)
    • engineered (5)
    • engineered (49-50)
    • engineered (110)
    • engineered (132)
  Domains in SCOP 1.73: d1rk7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rk7A (A:)
  atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheeedntagctsa
  gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
  ekaddlgkggneqstktgnagsrlacgvigiaq