PDB entry 1rk4

View 1rk4 on RCSB PDB site
Description: Crystal Structure of a Soluble Dimeric Form of Oxidised CLIC1
Class: ion transport/membrane protein
Keywords: glutathione-s-tranferase superfamily; chloride ion channel; redox-controlled structural transition, ion transport/membrane protein complex
Deposited on 2003-11-20, released 2003-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.178
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloride intracellular channel protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CLIC1, NCC27
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rk4a1, d1rk4a2
  • Chain 'B':
    Compound: chloride intracellular channel protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CLIC1, NCC27
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rk4b1, d1rk4b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rk4A (A:)
    gsmaeeqpqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqkl
    cpggqlpfllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayi
    knsnpalndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladc
    nllpklhivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvak
    alk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rk4A (A:)
    gncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggqlpfllygtevhtdtnkie
    efleavlcpprypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvld
    nyltsplpeevdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipe
    afrgvhrylsnayareefastcpddeeielaye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rk4B (B:)
    gsmaeeqpqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqkl
    cpggqlpfllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayi
    knsnpalndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladc
    nllpklhivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvak
    alk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rk4B (B:)
    gncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggqlpfllygtevhtdtnkie
    efleavlcpprypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvld
    nyltsplpeevdgvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhr
    ylsnayareefastcpddeeielaye