PDB entry 1rk1

View 1rk1 on RCSB PDB site
Description: Mhc Class I Natural H-2Kb Heavy Chain Complexed With beta-2 Microglobulin and Herpes Simplex Virus Mutant Glycoprotein B Peptide
Class: immune system
Keywords: MHC, class I, virus, TCR, herpes, IMMUNE SYSTEM
Deposited on 2003-11-20, released 2004-12-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.208
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: h-2 class I histocompatibility antigen, k-b alpha chain
  Species: Mus musculus [TaxId:10090]
  Gene: H2-K
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01901 (0-273)
  Domains in SCOPe 2.05: d1rk1a1, d1rk1a2
• Chain 'B':
  Compound: Beta-2-microglobulin
  Species: Mus musculus [TaxId:10090]
  Gene: B2M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01887 (0-98)
  Domains in SCOPe 2.05: d1rk1b_
• Chain 'P':
  Compound: Glycoprotein B
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06436 (0-7)
    • engineered (1)
• Heterogens: NAG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rk1A (A:)
  gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
  eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
  cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
  rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
  fqkwasvvvplgkeqyytchvyhqglpepltlrw
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rk1B (B:)
  iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
  sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
  

  
  
• Chain 'P':
  No sequence available.