PDB entry 1rk0

View 1rk0 on RCSB PDB site
Description: Mhc Class I H-2Kb Heavy Chain Complexed With beta-2 Microglobulin and Herpes Simplex Virus Glycoprotein B peptide
Class: immune system
Keywords: MHC, class I, peptide, virus, TCR, herpes
Deposited on 2003-11-20, released 2004-12-14
The last revision prior to the SCOP 1.73 freeze date was dated 2004-12-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.199
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: MUS MUSCULUS
    Gene: H2-K
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rk0a1, d1rk0a2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: MUS MUSCULUS
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rk0b_
  • Chain 'P':
    Compound: Glycoprotein B
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rk0A (A:)
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
fqkwasvvvplgkeqyytchvyhqglpepltlrw

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rk0B (B:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'P':
    No sequence available.