PDB entry 1rjw

View 1rjw on RCSB PDB site
Description: crystal structure of nad(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r
Class: oxidoreductase
Keywords: oxidoreductase, nad, zinc, alcohol, dehydrogenase, tetramer
Deposited on 2003-11-20, released 2004-05-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.214
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: ADH-HT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1rjwa1, d1rjwa2
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: ADH-HT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1rjwb1, d1rjwb2
  • Chain 'C':
    Compound: alcohol dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: ADH-HT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1rjwc1, d1rjwc2
  • Chain 'D':
    Compound: alcohol dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: ADH-HT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1rjwd1, d1rjwd2
  • Heterogens: ZN, ETF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjwA (A:)
    mkaavveqfkeplkikevekptisygevlvrikacgvchtdlhaahgdwpvkpklplipg
    hegvgiveevgpgvthlkvgdrvgipwlysacghcdyclsgqetlcehqknagysvdggy
    aeycraaadyvvkipdnlsfeeaapifcagvttykalkvtgakpgewvaiygigglghva
    vqyakamglnvvavdigdeklelakelgadlvvnplkedaakfmkekvggvhaavvtavs
    kpafqsaynsirrggacvlvglppeempipifdtvlngikiigsivgtrkdlqealqfaa
    egkvktiievqplekinevfdrmlkgqingrvvltledk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjwB (B:)
    mkaavveqfkeplkikevekptisygevlvrikacgvchtdlhaahgdwpvkpklplipg
    hegvgiveevgpgvthlkvgdrvgipwlysacghcdyclsgqetlcehqknagysvdggy
    aeycraaadyvvkipdnlsfeeaapifcagvttykalkvtgakpgewvaiygigglghva
    vqyakamglnvvavdigdeklelakelgadlvvnplkedaakfmkekvggvhaavvtavs
    kpafqsaynsirrggacvlvglppeempipifdtvlngikiigsivgtrkdlqealqfaa
    egkvktiievqplekinevfdrmlkgqingrvvltledk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjwC (C:)
    mkaavveqfkeplkikevekptisygevlvrikacgvchtdlhaahgdwpvkpklplipg
    hegvgiveevgpgvthlkvgdrvgipwlysacghcdyclsgqetlcehqknagysvdggy
    aeycraaadyvvkipdnlsfeeaapifcagvttykalkvtgakpgewvaiygigglghva
    vqyakamglnvvavdigdeklelakelgadlvvnplkedaakfmkekvggvhaavvtavs
    kpafqsaynsirrggacvlvglppeempipifdtvlngikiigsivgtrkdlqealqfaa
    egkvktiievqplekinevfdrmlkgqingrvvltledk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjwD (D:)
    mkaavveqfkeplkikevekptisygevlvrikacgvchtdlhaahgdwpvkpklplipg
    hegvgiveevgpgvthlkvgdrvgipwlysacghcdyclsgqetlcehqknagysvdggy
    aeycraaadyvvkipdnlsfeeaapifcagvttykalkvtgakpgewvaiygigglghva
    vqyakamglnvvavdigdeklelakelgadlvvnplkedaakfmkekvggvhaavvtavs
    kpafqsaynsirrggacvlvglppeempipifdtvlngikiigsivgtrkdlqealqfaa
    egkvktiievqplekinevfdrmlkgqingrvvltledk