PDB entry 1rjt

View 1rjt on RCSB PDB site
Description: nmr structure of cxc chemokine cxcl11/itac
Deposited on 2003-11-20, released 2004-04-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-13, with a file datestamp of 2004-04-13.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1rjta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjtA (A:)
    fpmfkrgrclcigpgvkavkvadiekasimypsnncdkieviitlkenkgqrclnpkskq
    arliikkverknf