PDB entry 1rjn

View 1rjn on RCSB PDB site
Description: The Crystal Structure of MenB (Rv0548c) from Mycobacterium tuberculosis in Complex with the CoA Portion of Naphthoyl CoA
Deposited on 2003-11-19, released 2004-11-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-30, with a file datestamp of 2004-11-30.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rjna_
  • Chain 'B':
    Domains in SCOP 1.71: d1rjnb_
  • Chain 'C':
    Domains in SCOP 1.71: d1rjnc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rjnA (A:)
    msyyhhhhhhnynipttenlyfqgamvapageqgrsstalsdnpfdakawrlvdgfddlt
    dityhrhvddatvrvafnrpevrnafrphtvdelyrvldharmspdvgvvlltgngpspk
    dggwafcsggdqrirgrsgyqyasgdtadtvdvaragrlhilevqrlirfmpkvviclvn
    gwaaggghslhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareiffl
    grtytaeqmhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgq
    qlfageatrlaymtdeavegrdaflqkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjnA (A:)
    dnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldha
    rmspdvgvvlltgngpspkdggwafcsggdqaragrlhilevqrlirfmpkvviclvngw
    aaggghslhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgr
    tytaeqmhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqql
    fageatrlaymtdeavegr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rjnB (B:)
    msyyhhhhhhnynipttenlyfqgamvapageqgrsstalsdnpfdakawrlvdgfddlt
    dityhrhvddatvrvafnrpevrnafrphtvdelyrvldharmspdvgvvlltgngpspk
    dggwafcsggdqrirgrsgyqyasgdtadtvdvaragrlhilevqrlirfmpkvviclvn
    gwaaggghslhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareiffl
    grtytaeqmhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgq
    qlfageatrlaymtdeavegrdaflqkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjnB (B:)
    alsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvl
    dharmspdvgvvlltgngpspkdggwafcsggdqrhilevqrlirfmpkvviclvngwaa
    ggghslhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrty
    taeqmhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfa
    geatrlaymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rjnC (C:)
    msyyhhhhhhnynipttenlyfqgamvapageqgrsstalsdnpfdakawrlvdgfddlt
    dityhrhvddatvrvafnrpevrnafrphtvdelyrvldharmspdvgvvlltgngpspk
    dggwafcsggdqrirgrsgyqyasgdtadtvdvaragrlhilevqrlirfmpkvviclvn
    gwaaggghslhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareiffl
    grtytaeqmhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgq
    qlfageatrlaymtdeavegrdaflqkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjnC (C:)
    alsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvl
    dharmspdvgvvlltgngpspkdggwafcsggdlhilevqrlirfmpkvviclvngwaag
    gghslhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtyt
    aeqmhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfag
    eatrl