PDB entry 1rjm

View 1rjm on RCSB PDB site
Description: crystal structure of menb (rv0548c) from mycobacterium tuberculosis
Deposited on 2003-11-19, released 2004-11-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-30, with a file datestamp of 2004-11-30.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.203
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rjma_
  • Chain 'B':
    Domains in SCOP 1.71: d1rjmb_
  • Chain 'C':
    Domains in SCOP 1.71: d1rjmc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rjmA (A:)
    msyyhhhhhhnynipttenlyfqgamvapageqgrsstalsdnpfdakawrlvdgfddlt
    dityhrhvddatvrvafnrpevrnafrphtvdelyrvldharmspdvgvvlltgngpspk
    dggwafcsggdqrirgrsgyqyasgdtadtvdvaragrlhilevqrlirfmpkvviclvn
    gwaaggghslhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareiffl
    grtytaeqmhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgq
    qlfageatrlaymtdeavegrdaflqkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjmA (A:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsgghilevqrlirfmpkvviclvngwaaggghslh
    vvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhq
    mgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rjmB (B:)
    msyyhhhhhhnynipttenlyfqgamvapageqgrsstalsdnpfdakawrlvdgfddlt
    dityhrhvddatvrvafnrpevrnafrphtvdelyrvldharmspdvgvvlltgngpspk
    dggwafcsggdqrirgrsgyqyasgdtadtvdvaragrlhilevqrlirfmpkvviclvn
    gwaaggghslhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareiffl
    grtytaeqmhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgq
    qlfageatrlaymtdeavegrdaflqkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjmB (B:)
    dnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldha
    rmspdvgvvlltgngpspkdggwafcsgghilevqrlirfmpkvviclvngwaaggghsl
    hvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmh
    qmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rjmC (C:)
    msyyhhhhhhnynipttenlyfqgamvapageqgrsstalsdnpfdakawrlvdgfddlt
    dityhrhvddatvrvafnrpevrnafrphtvdelyrvldharmspdvgvvlltgngpspk
    dggwafcsggdqrirgrsgyqyasgdtadtvdvaragrlhilevqrlirfmpkvviclvn
    gwaaggghslhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareiffl
    grtytaeqmhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgq
    qlfageatrlaymtdeavegrdaflqkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjmC (C:)
    dnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldha
    rmspdvgvvlltgngpspkdggwafcsggdlhilevqrlirfmpkvviclvngwaagggh
    slhvvcdltlasreyarfkqtdadfdggygsaylarqvgqkfareifflgrtytaeqmhq
    mgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatr