PDB entry 1rjl

View 1rjl on RCSB PDB site
Description: Structure of the complex between OspB-CT and bactericidal Fab-H6831
Class: immune system
Keywords: Beta Sheet, Antibody-Protein Complex, IMMUNE SYSTEM
Deposited on 2003-11-19, released 2004-11-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.191
AEROSPACI score: -1.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab H6831 L-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RJL (0-211)
    Domains in SCOPe 2.03: d1rjla1, d1rjla2
  • Chain 'B':
    Compound: Fab H6831 H-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RJL (0-220)
    Domains in SCOPe 2.03: d1rjlb1, d1rjlb2
  • Chain 'C':
    Compound: Outer surface protein B
    Species: Borrelia burgdorferi [TaxId:139]
    Gene: OSPB, BBA16
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1rjlc_
  • Chain 'D':
    Compound: Outer surface protein B
    Species: Borrelia burgdorferi [TaxId:139]
    Gene: OSPB, BBA16
    Database cross-references and differences (RAF-indexed):
    • PDB 1RJL (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjlA (A:)
    diqmnqspsslsaslgdtititchasqninvwlnwfqqkpgsipklliymasnlhtgvps
    rfsgsgsgtgftltisslqpediatyycqqgqsfpltfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjlB (B:)
    qvqlqqpgsvlvrpgasvklsckasgftftsswmhwakqrpgqglewigeihpnsgnthy
    nekfkgkatltvdtssstayvdlssltsedsavyycarmrygdyyamdnwgqgtsvtvss
    akttappvyplapvcgdttgssvtlgclvkgyfpesvtllwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjlC (C:)
    tveikegtvtlkreiekdgkvkvflndtagsnkktgkwedststltisadskktkdlvfl
    tdgtitvqqyntagtslegsaseiknlselknalk
    

  • Chain 'D':
    No sequence available.