PDB entry 1rjk

View 1rjk on RCSB PDB site
Description: crystal structure of the rat vitamin D receptor ligand binding domain complexed with 2MD and a synthetic peptide containing the NR2 box of DRIP 205
Class: hormone/growth factor receptor
Keywords: nuclear receptor-superagonist complex, nuclear receptor-coactivator interactions,, hormone/growth factor receptor COMPLEX
Deposited on 2003-11-19, released 2004-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.188
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rjka_
  • Chain 'C':
    Compound: Peroxisome proliferator-activated receptor binding protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: VDZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rjkA (A:)
    lkdslrpklseeqqhiiailldahhktydptyadfrdfrppvrmdgstgsvtldlsplsm
    lphladlvsysiqkvigfakmipgfrdltsddqivllkssaievimlrsnqsftmddmsw
    dcgsqdykydvtdvskaghtlelieplikfqvglkklnlheeehvllmaicivspdrpgv
    qdaklveaiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslneehskqyrslsf
    qpensmkltplvlevfgneislvprgsmaisdpnsssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjkA (A:)
    klseeqqhiiailldahhktydptyadfrdfrppvrmplsmlphladlvsysiqkvigfa
    kmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskagh
    tlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlqt
    yircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmkltplvlevfgn
    

  • Chain 'C':
    No sequence available.