PDB entry 1rjj
View 1rjj on RCSB PDB site
Description: Solution structure of a homodimeric hypothetical protein, At5g22580, a structural genomics target from Arabidopsis thaliana
Class: structural genomics, unknown function
Keywords: BETA BARREL, HOMODIMER, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, unknown function
Deposited on
2003-11-19, released
2003-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: expressed protein
Species: Arabidopsis thaliana [TaxId:3702]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1rjja_ - Chain 'B':
Compound: expressed protein
Species: Arabidopsis thaliana [TaxId:3702]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1rjjb_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1rjjA (A:)
matsgfkhlvvvkfkedtkvdeilkglenlvsqidtvksfewgedkeshdmlrqgfthaf
smtfenkdgyvaftshplhvefsaaftavidkivlldfpvaavkssvvatp
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1rjjB (B:)
matsgfkhlvvvkfkedtkvdeilkglenlvsqidtvksfewgedkeshdmlrqgfthaf
smtfenkdgyvaftshplhvefsaaftavidkivlldfpvaavkssvvatp