PDB entry 1rjj

View 1rjj on RCSB PDB site
Description: solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from arabidopsis thaliana
Deposited on 2003-11-19, released 2003-12-09
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-29, with a file datestamp of 2004-06-29.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1rjja_
  • Chain 'B':
    Domains in SCOP 1.69: d1rjjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rjjA (A:)
matsgfkhlvvvkfkedtkvdeilkglenlvsqidtvksfewgedkeshdmlrqgfthaf
smtfenkdgyvaftshplhvefsaaftavidkivlldfpvaavkssvvatp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rjjB (B:)
matsgfkhlvvvkfkedtkvdeilkglenlvsqidtvksfewgedkeshdmlrqgfthaf
smtfenkdgyvaftshplhvefsaaftavidkivlldfpvaavkssvvatp