PDB entry 1rjj

View 1rjj on RCSB PDB site
Description: solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from arabidopsis thaliana
Deposited on 2003-11-19, released 2003-12-09
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1rjja_
  • Chain 'B':
    Domains in SCOP 1.67: d1rjjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjjA (A:)
    matsgfkhlvvvkfkedtkvdeilkglenlvsqidtvksfewgedkeshdmlrqgfthaf
    smtfenkdgyvaftshplhvefsaaftavidkivlldfpvaavkssvvatp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjjB (B:)
    matsgfkhlvvvkfkedtkvdeilkglenlvsqidtvksfewgedkeshdmlrqgfthaf
    smtfenkdgyvaftshplhvefsaaftavidkivlldfpvaavkssvvatp