PDB entry 1rjj

View 1rjj on RCSB PDB site
Description: Solution structure of a homodimeric hypothetical protein, At5g22580, a structural genomics target from Arabidopsis thaliana
Class: structural genomics, unknown function
Keywords: BETA BARREL, HOMODIMER, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, unknown function
Deposited on 2003-11-19, released 2003-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: expressed protein
  Species: Arabidopsis thaliana [TaxId:3702]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9FK81 (0-110)
  Domains in SCOPe 2.08: d1rjja_
• Chain 'B':
  Compound: expressed protein
  Species: Arabidopsis thaliana [TaxId:3702]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9FK81 (0-110)
  Domains in SCOPe 2.08: d1rjjb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rjjA (A:)
  matsgfkhlvvvkfkedtkvdeilkglenlvsqidtvksfewgedkeshdmlrqgfthaf
  smtfenkdgyvaftshplhvefsaaftavidkivlldfpvaavkssvvatp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rjjB (B:)
  matsgfkhlvvvkfkedtkvdeilkglenlvsqidtvksfewgedkeshdmlrqgfthaf
  smtfenkdgyvaftshplhvefsaaftavidkivlldfpvaavkssvvatp