PDB entry 1rjh

View 1rjh on RCSB PDB site
Description:
Deposited on 2003-11-19, released 2004-07-20
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-20, with a file datestamp of 2004-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1rjha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjhA (A:)
    ftqtktfheasedcisrggtlstpqtgsendalyeylrqsvgneaeiwlglndmaaegtw
    vdmtgariayknweteitaqpdggktencavlsgaangkwfdkrcrdqlpyicqfgiv