PDB entry 1rjf

View 1rjf on RCSB PDB site
Description: Structure of PPM1, a leucine carboxy methyltransferase involved in the regulation of protein phosphatase 2A activity
Class: transferase
Keywords: SAM dependent methyltransferase, TRANSFERASE
Deposited on 2003-11-19, released 2003-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.186
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxy methyl transferase for protein phosphatase 2A catalytic subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PPM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04081 (Start-327)
      • expression tag (328)
    Domains in SCOPe 2.07: d1rjfa1, d1rjfa2
  • Chain 'B':
    Compound: carboxy methyl transferase for protein phosphatase 2A catalytic subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PPM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04081 (Start-327)
      • expression tag (328-329)
    Domains in SCOPe 2.07: d1rjfb1, d1rjfb2
  • Chain 'C':
    Compound: carboxy methyl transferase for protein phosphatase 2A catalytic subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PPM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04081 (Start-327)
      • expression tag (328-330)
    Domains in SCOPe 2.07: d1rjfc1, d1rjfc2
  • Heterogens: BME, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rjfA (A:)
    meriiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrraf
    gkvdkamrssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfp
    hlayvdidynesvelknsilreseilrislglskedtakspflidqgryklaacdlndit
    ettrlldvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpn
    drfgaimqsnlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserk
    rlrslqfldeleelkvmqthyilmkaqwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjfA (A:)
    dydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafgkvdkamr
    ssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfphlayvdid
    ynesvelknsilreseilrislglskedtakspflidqgryklaacdlnditettrlldv
    ctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpndrfgaimq
    snlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserkrlrslqfl
    deleelkvmqthyilmkaqwh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rjfB (B:)
    meriiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrraf
    gkvdkamrssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfp
    hlayvdidynesvelknsilreseilrislglskedtakspflidqgryklaacdlndit
    ettrlldvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpn
    drfgaimqsnlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserk
    rlrslqfldeleelkvmqthyilmkaqwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjfB (B:)
    iiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafgkv
    dkamrssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfphla
    yvdidynesvelknsilreseilrislglskedtakspflidqgryklaacdlnditett
    rlldvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpndrf
    gaimqsnlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserkrlr
    slqfldeleelkvmqthyilmkaqwhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rjfC (C:)
    meriiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrraf
    gkvdkamrssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfp
    hlayvdidynesvelknsilreseilrislglskedtakspflidqgryklaacdlndit
    ettrlldvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpn
    drfgaimqsnlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserk
    rlrslqfldeleelkvmqthyilmkaqwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjfC (C:)
    qtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafgkvdka
    mrssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfphlayvd
    idynesvelknsilreseilrislglskedtakspflidqgryklaacdlnditettrll
    dvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpndrfgai
    mqsnlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserkrlrslq
    fldeleelkvmqthyilmkaqwhhh