PDB entry 1rje

View 1rje on RCSB PDB site
Description: Structure of PPM1, a leucine carboxy methyltransferase involved in the regulation of protein phosphatase 2A activity
Class: transferase
Keywords: SAM dependent methyltransferase
Deposited on 2003-11-19, released 2003-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.161
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxy methyl transferase for protein phosphatase 2A catalytic subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PPM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04081 (Start-327)
      • expression tag (328)
    Domains in SCOPe 2.07: d1rjea1, d1rjea2
  • Chain 'B':
    Compound: carboxy methyl transferase for protein phosphatase 2A catalytic subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PPM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04081 (Start-327)
      • expression tag (328-329)
    Domains in SCOPe 2.07: d1rjeb1, d1rjeb2
  • Chain 'C':
    Compound: carboxy methyl transferase for protein phosphatase 2A catalytic subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PPM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04081 (Start-327)
      • expression tag (328-333)
    Domains in SCOPe 2.07: d1rjec1, d1rjec2
  • Heterogens: SO4, SAH, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rjeA (A:)
    meriiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrraf
    gkvdkamrssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfp
    hlayvdidynesvelknsilreseilrislglskedtakspflidqgryklaacdlndit
    ettrlldvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpn
    drfgaimqsnlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserk
    rlrslqfldeleelkvmqthyilmkaqwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjeA (A:)
    eriiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafg
    kvdkamrssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfph
    layvdidynesvelknsilreseilrislglskedtakspflidqgryklaacdlndite
    ttrlldvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpnd
    rfgaimqsnlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserkr
    lrslqfldeleelkvmqthyilmkaqwh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rjeB (B:)
    meriiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrraf
    gkvdkamrssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfp
    hlayvdidynesvelknsilreseilrislglskedtakspflidqgryklaacdlndit
    ettrlldvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpn
    drfgaimqsnlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserk
    rlrslqfldeleelkvmqthyilmkaqwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjeB (B:)
    eriiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafg
    kvdkamrssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfph
    layvdidynesvelknsilreseilrislglskedtakspflidqgryklaacdlndite
    ttrlldvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpnd
    rfgaimqsnlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserkr
    lrslqfldeleelkvmqthyilmkaqwhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rjeC (C:)
    meriiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrraf
    gkvdkamrssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfp
    hlayvdidynesvelknsilreseilrislglskedtakspflidqgryklaacdlndit
    ettrlldvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpn
    drfgaimqsnlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserk
    rlrslqfldeleelkvmqthyilmkaqwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjeC (C:)
    eriiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafg
    kvdkamrssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfph
    layvdidynesvelknsilreseilrislglskedtakspflidqgryklaacdlndite
    ttrlldvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpnd
    rfgaimqsnlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserkr
    lrslqfldeleelkvmqthyilmkaqwhhhhhh