PDB entry 1rja

View 1rja on RCSB PDB site
Description: Solution Structure and Backbone Dynamics of the Nonreceptor Tyrosine Kinase PTK6/Brk SH2 Domain
Class: transferase
Keywords: Human protein tyrosine kinase-6 (PTK6/Brk), Src homology 2(SH2) domain, Solution structure, Backbone dynamics, TRANSFERASE
Deposited on 2003-11-18, released 2004-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rjaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjaA (A:)
    sepwffgcisrseavrrlqaegnatgaflirvsekpsadyvlsvrdtqavrhykiwrrag
    grlhlneavsflslpelvnyhraqslshglrlaapcrkhe