PDB entry 1rj9

View 1rj9 on RCSB PDB site
Description: structure of the heterodimer of the conserved gtpase domains of the signal recognition particle (ffh) and its receptor (ftsy)
Deposited on 2003-11-18, released 2004-01-27
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rj9A (A:)
    mgffdrlkaglaktrerllkaipwggnleevleelemallaadvglsateeilqevrasg
    rkdlkeavkeklvgmlepderratlrklgfnpqkpkpvepkgrvvlvvgvngvgktttia
    klgryyqnlgkkvmfcagdtfraaggtqlsewgkrlsipviqgpegtdsaalaydavqam
    kargydllfvdtagrlhtkhnlmeelkkvkraiakadpeepkevwlvldavtgqngleqa
    kkfheavgltgvivtkldgtakggvlipivrtlkvpikfvgvgegpddlqpfdpeafvea
    lled
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj9A (A:)
    nleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlepderratlr
    klgfnpqkpkpvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraagg
    tqlsewgkrlsipviqgpegtdsaalaydavqamkargydllfvdtagrlhtkhnlmeel
    kkvkraiakadpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakggvl
    ipivrtlkvpikfvgvgegpddlqpfdpeafvealle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rj9B (B:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdvasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj9B (B:)
    grlrgrgriteedlkatlreirralmdadvnlevtrdfvervreealgkqvlesltpaev
    ilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllva
    adtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarleardlilvdtagrlq
    ideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarg
    gaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmg