SCOPe 2.06: Structural Classification of Proteins

PDB entry 1rj8

View 1rj8 on RCSB PDB site
Description: The crystal structure of TNF family member EDA-A2
Class: hormone/growth factor
Keywords: TNF domain, jelly roll, splice variant, trimer, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2003-11-18, released 2003-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.204
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: ectodysplasin-A isoform EDA-A2
Species: Homo sapiens [TaxId:9606]
Gene: EDA gene, splice form EDA-A2
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838 (Start-161)
Domains in SCOPe 2.06: d1rj8a_
Chain 'B':
Compound: ectodysplasin-A isoform EDA-A2
Species: Homo sapiens [TaxId:9606]
Gene: EDA gene, splice form EDA-A2
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838 (Start-161)
Domains in SCOPe 2.06: d1rj8b_
Chain 'D':
Compound: ectodysplasin-A isoform EDA-A2
Species: Homo sapiens [TaxId:9606]
Gene: EDA gene, splice form EDA-A2
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838 (Start-161)
Domains in SCOPe 2.06: d1rj8d_
Chain 'E':
Compound: ectodysplasin-A isoform EDA-A2
Species: Homo sapiens [TaxId:9606]
Gene: EDA gene, splice form EDA-A2
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838 (Start-161)
Domains in SCOPe 2.06: d1rj8e_
Chain 'F':
Compound: ectodysplasin-A isoform EDA-A2
Species: Homo sapiens [TaxId:9606]
Gene: EDA gene, splice form EDA-A2
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838 (Start-161)
Domains in SCOPe 2.06: d1rj8f_
Chain 'G':
Compound: ectodysplasin-A isoform EDA-A2
Species: Homo sapiens [TaxId:9606]
Gene: EDA gene, splice form EDA-A2
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838 (Start-161)
Domains in SCOPe 2.06: d1rj8g_
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1rj8A (A:)
gshmglqgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfk
lhprsgelevlvdgtyfiysqvyyinftdfasyevvvdekpflqctrsietgktnyntcy
tagvcllkarqkiavkmvhadisinmskhttffgairlgeapas