PDB entry 1rj8

View 1rj8 on RCSB PDB site
Description: The crystal structure of TNF family member EDA-A2
Class: hormone/growth factor
Keywords: TNF domain, jelly roll, splice variant, trimer, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2003-11-18, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ectodysplasin-A isoform EDA-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: EDA gene, splice form EDA-A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj8a_
  • Chain 'B':
    Compound: ectodysplasin-A isoform EDA-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: EDA gene, splice form EDA-A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj8b_
  • Chain 'D':
    Compound: ectodysplasin-A isoform EDA-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: EDA gene, splice form EDA-A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj8d_
  • Chain 'E':
    Compound: ectodysplasin-A isoform EDA-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: EDA gene, splice form EDA-A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj8e_
  • Chain 'F':
    Compound: ectodysplasin-A isoform EDA-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: EDA gene, splice form EDA-A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj8f_
  • Chain 'G':
    Compound: ectodysplasin-A isoform EDA-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: EDA gene, splice form EDA-A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj8g_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rj8A (A:)
    gshmglqgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfk
    lhprsgelevlvdgtyfiysqvyyinftdfasyevvvdekpflqctrsietgktnyntcy
    tagvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj8A (A:)
    pavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysqv
    yyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvhadi
    sinmskhttffgairlgeap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rj8B (B:)
    gshmglqgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfk
    lhprsgelevlvdgtyfiysqvyyinftdfasyevvvdekpflqctrsietgktnyntcy
    tagvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj8B (B:)
    pavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysqv
    yyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvhadi
    sinmskhttffgairlgeap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rj8D (D:)
    gshmglqgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfk
    lhprsgelevlvdgtyfiysqvyyinftdfasyevvvdekpflqctrsietgktnyntcy
    tagvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj8D (D:)
    pavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysqv
    yyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvhadi
    sinmskhttffgairlgeap
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rj8E (E:)
    gshmglqgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfk
    lhprsgelevlvdgtyfiysqvyyinftdfasyevvvdekpflqctrsietgktnyntcy
    tagvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj8E (E:)
    pavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysqv
    yyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvhadi
    sinmskhttffgairlgeap
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rj8F (F:)
    gshmglqgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfk
    lhprsgelevlvdgtyfiysqvyyinftdfasyevvvdekpflqctrsietgktnyntcy
    tagvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj8F (F:)
    pavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysqv
    yyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvhadi
    sinmskhttffgairlgeap
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1rj8G (G:)
    gshmglqgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfk
    lhprsgelevlvdgtyfiysqvyyinftdfasyevvvdekpflqctrsietgktnyntcy
    tagvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj8G (G:)
    pavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysqv
    yyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvhadi
    sinmskhttffgairlgeap