SCOPe 2.06: Structural Classification of Proteins

PDB entry 1rj7

View 1rj7 on RCSB PDB site
Description: Crystal structure of EDA-A1
Class: hormone/growth factor
Keywords: EDA, TNF, beta-bulge, morphogen, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2003-11-18, released 2003-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Ectodysplasin A
Species: Homo sapiens [TaxId:9606]
Gene: ED1, EDA
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838
Domains in SCOPe 2.06: d1rj7a_
Chain 'B':
Compound: Ectodysplasin A
Species: Homo sapiens [TaxId:9606]
Gene: ED1, EDA
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838
Domains in SCOPe 2.06: d1rj7b_
Chain 'D':
Compound: Ectodysplasin A
Species: Homo sapiens [TaxId:9606]
Gene: ED1, EDA
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838
Domains in SCOPe 2.06: d1rj7d_
Chain 'E':
Compound: Ectodysplasin A
Species: Homo sapiens [TaxId:9606]
Gene: ED1, EDA
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838
Domains in SCOPe 2.06: d1rj7e_
Chain 'F':
Compound: Ectodysplasin A
Species: Homo sapiens [TaxId:9606]
Gene: ED1, EDA
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838
Domains in SCOPe 2.06: d1rj7f_
Chain 'G':
Compound: Ectodysplasin A
Species: Homo sapiens [TaxId:9606]
Gene: ED1, EDA
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838
Domains in SCOPe 2.06: d1rj7g_
Chain 'H':
Compound: Ectodysplasin A
Species: Homo sapiens [TaxId:9606]
Gene: ED1, EDA
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838
Domains in SCOPe 2.06: d1rj7h_
Chain 'I':
Compound: Ectodysplasin A
Species: Homo sapiens [TaxId:9606]
Gene: ED1, EDA
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838
Domains in SCOPe 2.06: d1rj7i_
Chain 'J':
Compound: Ectodysplasin A
Species: Homo sapiens [TaxId:9606]
Gene: ED1, EDA
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838
Domains in SCOPe 2.06: d1rj7j_
Chain 'K':
Compound: Ectodysplasin A
Species: Homo sapiens [TaxId:9606]
Gene: ED1, EDA
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838 (Start-162)
Domains in SCOPe 2.06: d1rj7k_
Chain 'L':
Compound: Ectodysplasin A
Species: Homo sapiens [TaxId:9606]
Gene: ED1, EDA
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838
Domains in SCOPe 2.06: d1rj7l_
Chain 'M':
Compound: Ectodysplasin A
Species: Homo sapiens [TaxId:9606]
Gene: ED1, EDA
Database cross-references and differences (RAF-indexed):
- Uniprot Q92838
Domains in SCOPe 2.06: d1rj7m_
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1rj7A (A:)
gshmgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhp
rsgelevlvdgtyfiysqvevyyinftdfasyevvvdekpflqctrsietgktnyntcyt
agvcllkarqkiavkmvhadisinmskhttffgairlgeapas