PDB entry 1rj7

View 1rj7 on RCSB PDB site
Description: Crystal structure of EDA-A1
Class: hormone/growth factor
Keywords: EDA, TNF, beta-bulge, morphogen, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2003-11-18, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ectodysplasin A
    Species: Homo sapiens [TaxId:9606]
    Gene: ED1, EDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj7a_
  • Chain 'B':
    Compound: Ectodysplasin A
    Species: Homo sapiens [TaxId:9606]
    Gene: ED1, EDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj7b_
  • Chain 'D':
    Compound: Ectodysplasin A
    Species: Homo sapiens [TaxId:9606]
    Gene: ED1, EDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj7d_
  • Chain 'E':
    Compound: Ectodysplasin A
    Species: Homo sapiens [TaxId:9606]
    Gene: ED1, EDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj7e_
  • Chain 'F':
    Compound: Ectodysplasin A
    Species: Homo sapiens [TaxId:9606]
    Gene: ED1, EDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj7f_
  • Chain 'G':
    Compound: Ectodysplasin A
    Species: Homo sapiens [TaxId:9606]
    Gene: ED1, EDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj7g_
  • Chain 'H':
    Compound: Ectodysplasin A
    Species: Homo sapiens [TaxId:9606]
    Gene: ED1, EDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj7h_
  • Chain 'I':
    Compound: Ectodysplasin A
    Species: Homo sapiens [TaxId:9606]
    Gene: ED1, EDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj7i_
  • Chain 'J':
    Compound: Ectodysplasin A
    Species: Homo sapiens [TaxId:9606]
    Gene: ED1, EDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj7j_
  • Chain 'K':
    Compound: Ectodysplasin A
    Species: Homo sapiens [TaxId:9606]
    Gene: ED1, EDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj7k_
  • Chain 'L':
    Compound: Ectodysplasin A
    Species: Homo sapiens [TaxId:9606]
    Gene: ED1, EDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj7l_
  • Chain 'M':
    Compound: Ectodysplasin A
    Species: Homo sapiens [TaxId:9606]
    Gene: ED1, EDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rj7m_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rj7A (A:)
    gshmgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhp
    rsgelevlvdgtyfiysqvevyyinftdfasyevvvdekpflqctrsietgktnyntcyt
    agvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj7A (A:)
    qpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysq
    vevyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvh
    adisinmskhttffgairlgeapa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rj7B (B:)
    gshmgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhp
    rsgelevlvdgtyfiysqvevyyinftdfasyevvvdekpflqctrsietgktnyntcyt
    agvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj7B (B:)
    qpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysq
    vevyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvh
    adisinmskhttffgairlgeapa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rj7D (D:)
    gshmgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhp
    rsgelevlvdgtyfiysqvevyyinftdfasyevvvdekpflqctrsietgktnyntcyt
    agvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj7D (D:)
    qpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysq
    vevyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvh
    adisinmskhttffgairlgeapa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rj7E (E:)
    gshmgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhp
    rsgelevlvdgtyfiysqvevyyinftdfasyevvvdekpflqctrsietgktnyntcyt
    agvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj7E (E:)
    gtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgty
    fiysqvevyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkia
    vkmvhadisinmskhttffgairlgeapa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rj7F (F:)
    gshmgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhp
    rsgelevlvdgtyfiysqvevyyinftdfasyevvvdekpflqctrsietgktnyntcyt
    agvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj7F (F:)
    qpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysq
    vevyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvh
    adisinmskhttffgairlgeapa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1rj7G (G:)
    gshmgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhp
    rsgelevlvdgtyfiysqvevyyinftdfasyevvvdekpflqctrsietgktnyntcyt
    agvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj7G (G:)
    qpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysq
    vevyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvh
    adisinmskhttffgairlgeapa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rj7H (H:)
    gshmgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhp
    rsgelevlvdgtyfiysqvevyyinftdfasyevvvdekpflqctrsietgktnyntcyt
    agvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj7H (H:)
    qpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysq
    vevyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvh
    adisinmskhttffgairlgea
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1rj7I (I:)
    gshmgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhp
    rsgelevlvdgtyfiysqvevyyinftdfasyevvvdekpflqctrsietgktnyntcyt
    agvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj7I (I:)
    qpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysq
    vevyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvh
    adisinmskhttffgairlgeap
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1rj7J (J:)
    gshmgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhp
    rsgelevlvdgtyfiysqvevyyinftdfasyevvvdekpflqctrsietgktnyntcyt
    agvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj7J (J:)
    pavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysqv
    evyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvha
    disinmskhttffgairlgeapa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1rj7K (K:)
    gshmgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhp
    rsgelevlvdgtyfiysqvevyyinftdfasyevvvdekpflqctrsietgktnyntcyt
    agvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj7K (K:)
    qpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysq
    vevyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvh
    adisinmskhttffgairlgeapas
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rj7L (L:)
    gshmgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhp
    rsgelevlvdgtyfiysqvevyyinftdfasyevvvdekpflqctrsietgktnyntcyt
    agvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj7L (L:)
    nqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiys
    qvevyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmv
    hadisinmskhttffgairlgeapa
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1rj7M (M:)
    gshmgpsgaadkagtrenqpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhp
    rsgelevlvdgtyfiysqvevyyinftdfasyevvvdekpflqctrsietgktnyntcyt
    agvcllkarqkiavkmvhadisinmskhttffgairlgeapas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj7M (M:)
    qpavvhlqgqgsaiqvkndlsggvlndwsritmnpkvfklhprsgelevlvdgtyfiysq
    vevyyinftdfasyevvvdekpflqctrsietgktnyntcytagvcllkarqkiavkmvh
    adisinmskhttffgairlgeapa