PDB entry 1rj4

View 1rj4 on RCSB PDB site
Description: Structure of a Cell Wall Invertase Inhibitor from Tobacco in Complex with Cd2+
Class: protein binding
Keywords: four-helix bundle, helical hairpin, cadmium coordination, bis-tris buffer
Deposited on 2003-11-18, released 2004-02-03
The last revision prior to the SCOP 1.73 freeze date was dated 2004-02-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: invertase inhibitor
    Species: Nicotiana tabacum
    Gene: NTINH1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rj4a_
  • Chain 'B':
    Compound: invertase inhibitor
    Species: Nicotiana tabacum
    Gene: NTINH1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rj4b_
  • Chain 'C':
    Compound: invertase inhibitor
    Species: Nicotiana tabacum
    Gene: NTINH1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rj4c_
  • Chain 'D':
    Compound: invertase inhibitor
    Species: Nicotiana tabacum
    Gene: NTINH1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rj4d_
  • Heterogens: CD, BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rj4A (A:)
    gamgnnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisk
    lrhsnppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqecee
    yfkgskspfsalniavhelsdvgraivrnll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj4A (A:)
    nnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhs
    nppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkg
    skspfsalniavhelsdvgraivrnll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rj4B (B:)
    gamgnnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisk
    lrhsnppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqecee
    yfkgskspfsalniavhelsdvgraivrnll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj4B (B:)
    nlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhsn
    ppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkgs
    kspfsalniavhelsdvgraivrnll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rj4C (C:)
    gamgnnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisk
    lrhsnppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqecee
    yfkgskspfsalniavhelsdvgraivrnll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj4C (C:)
    nlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhsn
    ppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkgs
    kspfsalniavhelsdvgraivrnll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rj4D (D:)
    gamgnnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisk
    lrhsnppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqecee
    yfkgskspfsalniavhelsdvgraivrnll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj4D (D:)
    nlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhsn
    ppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkgs
    kspfsalniavhelsdvgraivrnll