PDB entry 1rj2

View 1rj2 on RCSB PDB site
Description: Crystal structure of the DH/PH fragment of Dbs without bound GTPase
Class: signaling protein
Keywords: Dbl homology; Pleckstrin homology; Guanine nucleotide exchange factor; Rho GTPase, SIGNALING PROTEIN
Deposited on 2003-11-18, released 2004-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.239
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide exchange factor DBS [Fragment]
    Species: Mus musculus [TaxId:10090]
    Gene: MCF2L, OST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rj2a1, d1rj2a2
  • Chain 'D':
    Compound: Guanine nucleotide exchange factor DBS [Fragment]
    Species: Mus musculus [TaxId:10090]
    Gene: MCF2L, OST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rj2d1, d1rj2d2
  • Chain 'G':
    Compound: Guanine nucleotide exchange factor DBS [Fragment]
    Species: Mus musculus [TaxId:10090]
    Gene: MCF2L, OST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rj2g1, d1rj2g2
  • Chain 'J':
    Compound: Guanine nucleotide exchange factor DBS [Fragment]
    Species: Mus musculus [TaxId:10090]
    Gene: MCF2L, OST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rj2j1, d1rj2j2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rj2A (A:)
    mgeeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkkni
    lfgnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrq
    csdcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealss
    ilgilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqr
    hlflhekavlfckkreengegyekapsysykqslnmtavgitenvkgdtkkfeiwynare
    evyiiqaptpeikaawvneirkvltsqlqacreasqhraleqshslphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj2A (A:)
    eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
    gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
    dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
    gilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkarfkpmqrhlflhekavlf
    ckkrepsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawvnei
    rkvltsqlqacreasqh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rj2D (D:)
    mgeeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkkni
    lfgnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrq
    csdcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealss
    ilgilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqr
    hlflhekavlfckkreengegyekapsysykqslnmtavgitenvkgdtkkfeiwynare
    evyiiqaptpeikaawvneirkvltsqlqacreasqhraleqshslphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj2D (D:)
    eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
    gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
    dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
    gilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkelarfkpmqrhlflheka
    vlfckkreekapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeika
    awvneirkvltsqlqacreasqhraleqshs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1rj2G (G:)
    mgeeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkkni
    lfgnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrq
    csdcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealss
    ilgilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqr
    hlflhekavlfckkreengegyekapsysykqslnmtavgitenvkgdtkkfeiwynare
    evyiiqaptpeikaawvneirkvltsqlqacreasqhraleqshslphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj2G (G:)
    eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
    gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
    dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
    gilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdkpmqrhlflhekavlfckkry
    ekapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawvneirk
    vltsqlq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1rj2J (J:)
    mgeeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkkni
    lfgnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrq
    csdcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealss
    ilgilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqr
    hlflhekavlfckkreengegyekapsysykqslnmtavgitenvkgdtkkfeiwynare
    evyiiqaptpeikaawvneirkvltsqlqacreasqhraleqshslphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj2J (J:)
    eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
    gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
    dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
    gilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqrhl
    flhekavlfckkreysykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeik
    aawvneirkvltsqlqac