PDB entry 1rj1

View 1rj1 on RCSB PDB site
Description: Crystal Structure of a Cell Wall Invertase Inhibitor from Tobacco
Class: protein binding
Keywords: four-helix bundle, helical hairpin, protein binding
Deposited on 2003-11-18, released 2004-02-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: invertase inhibitor
    Species: Nicotiana tabacum [TaxId:4097]
    Gene: NTINH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O49908 (4-150)
      • cloning artifact (3)
    Domains in SCOPe 2.08: d1rj1a1, d1rj1a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rj1A (A:)
    gamgnnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisk
    lrhsnppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqecee
    yfkgskspfsalniavhelsdvgraivrnll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj1A (A:)
    gnnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrh
    snppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfk
    gskspfsalniavhelsdvgraivrnll