PDB entry 1riy

View 1riy on RCSB PDB site
Description: hu mutant v42i from thermotoga maritima
Deposited on 2003-11-18, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.219
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1riya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1riyA (A:)
    mnkkelidrvakkagakkkdvklildtiletitealakgekiqivgfgsfevrkaaarkg
    vnpqtrkpitiperkvpkfkpgkalkekvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1riyA (A:)
    mnkkelidrvakkagakkkdvklildtiletitealakgekiqivgfgsfevrkrkvpkf
    kpgkalkekvk