PDB entry 1riy

View 1riy on RCSB PDB site
Description: HU mutant V42I from Thermotoga maritima
Class: DNA binding protein
Keywords: histone-like protein, thermostable DNA-binding protein, hu protein mutant v42i, thermotoga maritima, DNA binding protein
Deposited on 2003-11-18, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hu DNA-binding protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: HUP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36206 (0-89)
      • see remark 999 (1)
      • engineered (41)
    Domains in SCOPe 2.07: d1riya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1riyA (A:)
    mnkkelidrvakkagakkkdvklildtiletitealakgekiqivgfgsfevrkaaarkg
    vnpqtrkpitiperkvpkfkpgkalkekvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1riyA (A:)
    mnkkelidrvakkagakkkdvklildtiletitealakgekiqivgfgsfevrkrkvpkf
    kpgkalkekvk