PDB entry 1riw

View 1riw on RCSB PDB site
Description: Thrombin in complex with natural product inhibitor Oscillarin
Class: hydrolase/blood clotting
Keywords: protease, Thrombin, inhibitor complex, oscillarin
Deposited on 2003-11-18, released 2004-11-09
The last revision prior to the SCOP 1.75 freeze date was dated 2004-11-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.213
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thrombin light chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1riw.1
  • Chain 'B':
    Compound: thrombin heavy chain, B
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1riw.1
  • Chain 'C':
    Compound: thrombin heavy chain, C
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1riw.1
  • Chain 'D':
    Compound: hirudin iib
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, SO4, NA, OSC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1riwA (A:)
    tfgsgeadcglrplfekksledkterellesyidgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1riwA (A:)
    adcglrplfekksledkterellesyi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1riwB (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlket
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1riwC (C:)
    gqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmksp
    fnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1riwC (C:)
    gqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmksp
    fnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidq
    

  • Chain 'D':
    No sequence available.