PDB entry 1riw

View 1riw on RCSB PDB site
Description: Thrombin in complex with natural product inhibitor Oscillarin
Class: hydrolase/hydrolase inhibitor
Keywords: protease, Thrombin, inhibitor complex, oscillarin, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2003-11-18, released 2004-11-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thrombin light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1riw.1
  • Chain 'B':
    Compound: thrombin heavy chain, B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1riw.1
  • Chain 'C':
    Compound: thrombin heavy chain, C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1riw.1
  • Chain 'D':
    Compound: hirudin iib
    Species: Hirudo medicinalis, synthetic [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, NA, OSC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1riwA (A:)
    tfgsgeadcglrplfekksledkterellesyidgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1riwA (A:)
    adcglrplfekksledkterellesyi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1riwB (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlket
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1riwC (C:)
    gqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmksp
    fnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1riwC (C:)
    gqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmksp
    fnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidq
    

  • Chain 'D':
    No sequence available.