PDB entry 1riu

View 1riu on RCSB PDB site
Description: Anti-Cocaine Antibody M82G2 Complexed With Norbenzoylecgonine
Class: immune system
Keywords: anti-cocaine antibody, fab, immune system
Deposited on 2003-11-18, released 2003-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab M82G2, Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RIU (0-222)
    Domains in SCOPe 2.07: d1riuh1, d1riuh2
  • Chain 'L':
    Compound: Fab M82G2, Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RIU (0-217)
    Domains in SCOPe 2.07: d1riul1, d1riul2
  • Heterogens: RBE, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1riuH (H:)
    evtlqesggglvqpggsmklscaasgftfsdawvdwvrqspgkglewvaeirnkannhat
    kytesvkgrftisrddskssvylqmnslraedtgiyyctsvpqlgrgfaywgqgtlvtvs
    aasttppsvyplapgsggastsgsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavl
    qsdlytlsssvtvpsstwpsqtvtcnvahpasstqvdkkivpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1riuH (H:)
    evtlqesggglvqpggsmklscaasgftfsdawvdwvrqspgkglewvaeirnkannhat
    kytesvkgrftisrddskssvylqmnslraedtgiyyctsvpqlgrgfaywgqgtlvtvs
    aasttppsvyplapgsggagsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsd
    lytlsssvtvpsstwpsqtvtcnvahpasstqvdkkivpk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1riuL (L:)
    divmtqaapsvpvtpgesvsiscrssksllhsngytylhwflqrpgqspqlliyrvsnla
    sgvpdrfsgsgsgtaftlrfsrveaedvgvyycmqhleypftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypqditvswkidgaerssgvlnswtdqdssdstysm
    sstltltkdeyerhssytceathktstspitksfnrge