PDB entry 1ris

View 1ris on RCSB PDB site
Description: crystal structure of the ribosomal protein s6 from thermus thermophilus
Deposited on 1994-05-31, released 1994-09-30
The last revision prior to the SCOP 1.61 freeze date was dated 1994-09-30, with a file datestamp of 1994-10-05.
Experiment type: -
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1ris__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ris_ (-)
  mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
  lwyqvempedrvndlarelrirdnvrrvmvvksqepf