PDB entry 1riq

View 1riq on RCSB PDB site
Description: The crystal structure of the catalytic fragment of the alanyl-tRNA synthetase
Deposited on 2003-11-17, released 2004-04-06
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.207
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1riqA (A:)
    mslsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpyk
    ratscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlk
    lpkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdr
    geeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnfeid
    iifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvirril
    rramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktlkag
    meyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqcelee
    qrerarkhfkveakkvkpvyshlkelgktsafvgaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1riqA (A:)
    slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
    atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
    pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
    eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnfeidi
    ifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvirrilr
    ramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktlkagm
    eyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqceleeq
    rerarkhpvyshlkelgktsafvgaaal