PDB entry 1riq

View 1riq on RCSB PDB site
Description: The crystal structure of the catalytic fragment of the alanyl-tRNA synthetase
Class: ligase
Keywords: beta sheet and flanking helices, class II aminoacyl-tRNA synthetase, helix-loop-helix motif, LIGASE
Deposited on 2003-11-17, released 2004-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.207
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alanyl-tRNA synthetase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: ALAS, AQ_1293
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67323 (Start-453)
      • modified residue (43)
      • modified residue (92)
      • modified residue (163)
      • modified residue (198)
      • modified residue (220)
      • modified residue (303)
      • modified residue (327)
      • modified residue (360)
      • cloning artifact (454-457)
    Domains in SCOPe 2.07: d1riqa1, d1riqa2, d1riqa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1riqA (A:)
    mslsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpyk
    ratscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlk
    lpkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdr
    geeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnfeid
    iifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvirril
    rramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktlkag
    meyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqcelee
    qrerarkhfkveakkvkpvyshlkelgktsafvgaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1riqA (A:)
    slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
    atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
    pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
    eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnfeidi
    ifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvirrilr
    ramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktlkagm
    eyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqceleeq
    rerarkhpvyshlkelgktsafvgaaal