PDB entry 1rip

View 1rip on RCSB PDB site
Description: ribosomal protein s17: characterization of the three-dimensional structure by 1h-and 15n-nmr
Class: ribosomal protein
Keywords: ribosomal protein
Deposited on 1993-08-17, released 1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 1993-10-31, with a file datestamp of 2007-07-20.
Experiment type: NMR6
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s17
    Species: Bacillus stearothermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ripa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ripA (A:)
qrkvyvgrvvsdkmdktitvlvetykkhplygkrvkyskkykahdehneakvgdivkime
trplsatkrfrlveivekavr