PDB entry 1rip

View 1rip on RCSB PDB site
Description: ribosomal protein s17: characterization of the three-dimensional structure by 1h-and 15n-nmr
Class: ribosomal protein
Keywords: ribosomal protein
Deposited on 1993-08-17, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s17
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ripa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ripA (A:)
    qrkvyvgrvvsdkmdktitvlvetykkhplygkrvkyskkykahdehneakvgdivkime
    trplsatkrfrlveivekavr