PDB entry 1rio

View 1rio on RCSB PDB site
Description: Structure of bacteriophage lambda cI-NTD in complex with sigma-region4 of Thermus aquaticus bound to DNA
Deposited on 2003-11-17, released 2004-01-27
The last revision prior to the SCOP 1.71 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.218
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rioa_
  • Chain 'B':
    Domains in SCOP 1.71: d1riob_
  • Chain 'H':
    Domains in SCOP 1.71: d1rioh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rioA (A:)
    mstkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalna
    ynaallakilkvsveefspsiareiyemyeavhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rioA (A:)
    stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
    naallakilkvsveefspsiareiyemyeavhhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rioB (B:)
    mstkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalna
    ynaallakilkvsveefspsiareiyemyeavhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rioB (B:)
    stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
    naallakilkvsveefspsiareiyemyeavhhhhh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rioH (H:)
    seelekalsklsereamvlklrkglidgrehtleevgayfgvtrerirqienkalrklky
    hesrtrklrdfle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rioH (H:)
    seelekalsklsereamvlklrkglidgrehtleevgayfgvtrerirqienkalrklky
    h