PDB entry 1rin

View 1rin on RCSB PDB site
Description: x-ray crystal structure of a pea lectin-trimannoside complex at 2.6 angstroms resolution
Deposited on 1993-01-27, released 1993-10-31
The last revision prior to the SCOP 1.67 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.183
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1rin.1
  • Chain 'B':
    Domains in SCOP 1.67: d1rin.1
  • Chain 'C':
    Domains in SCOP 1.67: d1rin.2
  • Chain 'D':
    Domains in SCOP 1.67: d1rin.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rinA (A:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttetvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rinB (B:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rinC (C:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttetvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rinD (D:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsgt