PDB entry 1rim

View 1rim on RCSB PDB site
Description: e6-binding zinc finger (e6apc2)
Deposited on 2003-11-17, released 2004-08-03
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: NMR29
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1rima_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rimA (A:)
  ykfacpecpkrfmrsdhlskhitlhellgeerr