PDB entry 1rim

View 1rim on RCSB PDB site
Description: E6-binding zinc finger (E6apc2)
Class: de novo protein
Keywords: E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, DE NOVO PROTEIN
Deposited on 2003-11-17, released 2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E6apc2 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1RIM (0-32)
    Domains in SCOPe 2.08: d1rima_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rimA (A:)
    ykfacpecpkrfmrsdhlskhitlhellgeerr